NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272447_1037634

Scaffold Ga0272447_1037634


Overview

Basic Information
Taxon OID3300028761 Open in IMG/M
Scaffold IDGa0272447_1037634 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)818
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5761Long. (o)-110.7905Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061874Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0272447_10376342F061874N/AMTASTNMSSSPKENPTPLWRLKANYVLRELVRAWHGRPYDSAVMWGLGYAFEDILCTFAKENDLPIPKLFFWFERFWRKYSGYLGERVFTGIDRTKLVDVLLCGFPSARADLCKVFLYDQSIYGIMHLASVLCLWESGRGERVKCYKWWKWPLEYYESLEVAPLDSFVIWQVKRMLNEQTKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.