NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307299_10233424

Scaffold Ga0307299_10233424


Overview

Basic Information
Taxon OID3300028793 Open in IMG/M
Scaffold IDGa0307299_10233424 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)691
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006214Metagenome / Metatranscriptome378Y

Sequences

Protein IDFamilyRBSSequence
Ga0307299_102334241F006214GGAGGMTLLLLLLLQAAPTSQAPAGATAAWTLKTKGAIRWQQVTPAGALLVSTDASLAAVDMERGVVTWEKPELAGLPVDSVRMVEGSLLMEAARPGLLIVFDPVTGGVVFDSRKLSLTQVVTRRVLPQSGSLLVHGRRAQGPPVVALYDLTTGAQRWASESLFQESGPKRGGLGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.