NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265301_10058606

Scaffold Ga0265301_10058606


Overview

Basic Information
Taxon OID3300028797 Open in IMG/M
Scaffold IDGa0265301_10058606 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2974
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameAustralia: Woodstock, Queensland
CoordinatesLat. (o)-19.6574Long. (o)146.8351Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065312Metagenome / Metatranscriptome127Y
F086398Metagenome / Metatranscriptome110Y
F087968Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0265301_100586066F065312AGGAMSKKKCKTWTEIFQSERKQFPQGCCVTRVIPDKRNKKPKYKLKEFNE
Ga0265301_100586068F087968AGGAMVKITKALAKKMYEQGHAIMVVPCKVRPDGKLASWISKPDDPDATFEKLCNAIFYYNCSPETGMNLVYYAKEV
Ga0265301_100586069F086398AGGAGGMNEQMSYHVRVDRAERVKHIVEEIGIGQVIKEKYTRYNIQQAGCYICLTDTGITIIKSEDKQKIITMYVTTQRELVSVFGGAKKIPPFLKKKVDHNQSKFTQAGKTIWK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.