Scaffold Ga0265301_11126961

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265301_11126961

Scaffold Ga0265301_11126961

Overview

Basic Information
Taxon OID	3300028797 Open in IMG/M
Scaffold ID	Ga0265301_11126961 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	560
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Australia: Woodstock, Queensland
Coordinates	Lat. (^o)	-19.6574	Long. (^o)	146.8351	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052998	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265301_111269611	F052998	N/A	TQLKDFQMLTNMAKVNTKKLNKEDFSILEIMSNRAETAELEVQKLMAYIEELKALNENIRKKIKPLEDYALLQIKHDHEISLNNDTIFDIQNKIFTEEEKKEISKLKNEPNELFQTLIKLKTENLELHKHLKDITIECNQTLRQIKWKNK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.