NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265338_10001621

Scaffold Ga0265338_10001621


Overview

Basic Information
Taxon OID3300028800 Open in IMG/M
Scaffold IDGa0265338_10001621 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)36016
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (77.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States

Source Dataset Sampling Location
Location NameUSA: Seattle, Washington
CoordinatesLat. (o)47.6516Long. (o)-122.3045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000260Metagenome / Metatranscriptome1431Y
F000272Metagenome / Metatranscriptome1408Y
F002363Metagenome / Metatranscriptome567Y

Sequences

Protein IDFamilyRBSSequence
Ga0265338_1000162123F000260AGGAMMTSTTKMILGILTALAMLLLTFAIPRGGALRDAQLVLFPLTVGVWAIFVLLFVKLK
Ga0265338_1000162126F000272GGAGGMSKTVVERAADQIADSADQAKRATSAVADAIGSGVGAVRRATRQGGDAAEEFLDDTAHRMQRHLLLTLATTFAVGVATGALIGWASQRR
Ga0265338_1000162133F002363AGGMDNLGVCLLIQLFLVFGVAGLLWPDKFIPLFDVLLFPWAASYRAIRANSIAAIAGSVLLFVKLFNH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.