Scaffold Ga0268298_10000872

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268298_10000872

Scaffold Ga0268298_10000872

Overview

Basic Information
Taxon OID	3300028804 Open in IMG/M
Scaffold ID	Ga0268298_10000872 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	37732
Total Scaffold Genes	38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (81.58%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location
Location Name	Netherlands: Nijmegen, Gelderland
Coordinates	Lat. (^o)	51.82	Long. (^o)	5.87	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007038	Metagenome / Metatranscriptome	359	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268298_1000087214	F007038	GGAGG	MTRRIFLDTEWTKPPWSKQSELMWIGLADEEGRSWYGISSEVDIDPSTNDFISGVFRLITPDEPRLTNEEIATAVIDFCGDVDEFWAWIPTLERFAEWFDLGEEAAELYARHWNVDLQMVRSLVQPWPDGWPDRLLDLNAAAVEAGVEVPPRAVNHLHPRVHAEWNRELFELIRMSRES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.