NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268298_10126699

Scaffold Ga0268298_10126699


Overview

Basic Information
Taxon OID3300028804 Open in IMG/M
Scaffold IDGa0268298_10126699 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1478
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location
Location NameNetherlands: Nijmegen, Gelderland
CoordinatesLat. (o)51.82Long. (o)5.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105218Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0268298_101266991F105218N/AISYLTQVGDLVVTGAQVCANNSITFNAGPALVFSACRTVTCPPPGPGNLFPARSEMSDQKAGSVLVYNVYTSGATSGNTQNTRLNITNVHSVLPAFVHLFFVAEGCSIADTYICLTQNQTASFLASDLDPGTTGYVVALAVDERGCPRNFNYLIGDEYVKFTSGHAANLGAQGFAAIPGGLPLCDGNSVTSTIAFDGISYNHVPRVLAASNVGARADGNDTLLILNRIGGNLGIGASTLGTLFGLLYDDAENSLSFSISGSCQLRGSLSNNFPRTAPRFETFIPAGRTGWLKFFSQSPTDIGILGAQINFNANAASSAGAFNQGHNLHALTLSATNSYNIPVFPPGC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.