NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307278_10000576

Scaffold Ga0307278_10000576


Overview

Basic Information
Taxon OID3300028878 Open in IMG/M
Scaffold IDGa0307278_10000576 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18371
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (47.37%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019013Metagenome / Metatranscriptome232N
F022289Metagenome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0307278_1000057610F022289GAGMRPNQSLEPTADRTWALWGKHMHTFLHSAGSARQLALLALLLSFPVTLCRGEAATQDQSTEYDRIVQLISDEDWKAASDAAATYLAKVGTSGDKGLQARLRYIIIYATAGAVSTGVFEFDVLDQRLKGFVGKSVTLPDRPVVNGACPGGMNAICISDPDPTSFIVVAANKTSTTIHAFEYVKLRQAMDFAAHTGEWGSITGTLRKIAPNPNKSRAIVMRVYIDDATVAFSKHS
Ga0307278_1000057611F019013N/AMKSPLLVSSVILAVCTTGYGQQQDQSVEKRLSDLEKRVTALEKASPLSSPLNAVSPTPPLATKSPLELVAWDAHLVRGEDSYDKYNISLTLKNNSDKDVRFTEATVQFADLLGSHIYDIKVNPDHLIPAGQSITDTGQYPINQLMPEQTRLGQMKKEDVKATLVVSKLVFADNSIGEYAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.