NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307277_10000169

Scaffold Ga0307277_10000169


Overview

Basic Information
Taxon OID3300028881 Open in IMG/M
Scaffold IDGa0307277_10000169 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21484
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (78.12%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003118Metagenome / Metatranscriptome506Y
F006486Metagenome / Metatranscriptome372Y
F029854Metagenome / Metatranscriptome187Y
F055238Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0307277_1000016914F003118AGGAGGVPQVDPWEKAADCERALRITIDPIHRETLSNIREFWIALAQESRFLSEDALAAQIETIGRLHAKLDRDMHA
Ga0307277_1000016921F055238GGAMPNLLNHLAAPDCSRVGSQWDRCGVHYVEPIETDFAR
Ga0307277_1000016923F029854AGGAGMKPSSLRIERLLAKVEAALARSARPRRYCFYYDEEAEAEAQGLPYVLLPRPLSREEWEKEYCHKEPEASS
Ga0307277_1000016924F006486N/AMFEADFVSKDSDQTVAAPRKFKLGPLGSLNQVTKGLAKTIRAMADGTLDSQVGARICNGLGIMRACLETQKLEQLEARMDEIADRVARDRSNAARERSSHP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.