NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307308_10432067

Scaffold Ga0307308_10432067


Overview

Basic Information
Taxon OID3300028884 Open in IMG/M
Scaffold IDGa0307308_10432067 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082446Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0307308_104320671F082446N/ALAWSLGWRAKHSGVPPWRTVATTVTATVVWFLLSGALPEAGREPKITVGDRGTRPGGGFTNSVSNAFQRAQLESLQVRAEQFGPSGAFAEFSCRDSVPDFRFEMTLEPAGEYNERLVDVGYTPHLDVGGADRCLSFGLSYLFDTTIAEIDHGPPVDYGYVNPSTGEKLGPYIRGPLRKPICRCDLRHSGREWVAWSPQAAEALH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.