Scaffold Ga0265300_10902882

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265300_10902882

Scaffold Ga0265300_10902882

Overview

Basic Information
Taxon OID	3300028914 Open in IMG/M
Scaffold ID	Ga0265300_10902882 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_03
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	593
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Australia: Woodstock, Queensland
Coordinates	Lat. (^o)	-19.6574	Long. (^o)	146.8351	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046116	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265300_109028822	F046116	N/A	LIAGLNMAEMRRMRPGAIIDLYIYRRNYDDVQHRVIRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.