Scaffold Ga0272441_10030236

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0272441_10030236

Scaffold Ga0272441_10030236

Overview

Basic Information
Taxon OID	3300028920 Open in IMG/M
Scaffold ID	Ga0272441_10030236 Open in IMG/M
Source Dataset Name	Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6660
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (76.47%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States

Source Dataset Sampling Location
Location Name	USA: Falmouth, Massachusetts
Coordinates	Lat. (^o)	41.5758	Long. (^o)	-70.6394	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014681	Metagenome / Metatranscriptome	261	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272441_1003023610	F014681	AGGAGG	MRSLLNDVRGVIDLGVVLMIGIAFAGLMVVSYIIFTLVDQLGATGDAAYTIGNITAGFDNAIALILVAITIFILAIAISALLMLRSRK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.