NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272441_10041476

Scaffold Ga0272441_10041476


Overview

Basic Information
Taxon OID3300028920 Open in IMG/M
Scaffold IDGa0272441_10041476 Open in IMG/M
Source Dataset NameMarine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5355
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment → Marine Sediment Archaeal Communities From Little Sippewissett Salt Marsh, Falmouth, Ma, United States

Source Dataset Sampling Location
Location NameUSA: Falmouth, Massachusetts
CoordinatesLat. (o)41.5758Long. (o)-70.6394Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049073Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0272441_100414765F049073GAGGMNREIKEQIVFVLEDDNELMTAALASDSDLDVENKQMNRELIKKHEGIIAQVEKGKWPTQAELQLIRDANEIHLNDEDNLNGRHAQAVKLNDWLDQMTEFSKNEAMKILEQYLDKDPHTPINVYMALHTLWEEATPNGMAEKPLFDDKGKCLTCGSKVSFADVTDTLVFVGDEIVKRYDGDITNRNCVKCTYPNQYPEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.