 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300029025 Open in IMG/M |
| Scaffold ID | Ga0169590_101633 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from infant at 12 months in Denmark - 256_12M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4627 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark | |||||||
| Coordinates | Lat. (o) | 55.676097 | Long. (o) | 12.568337 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0169590_1016333 | F047125 | AGGA | MDVVLLLMVLGVMLSGFRAADALDHMREEIIRQEGKRRGWWS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |