Scaffold Ga0169694_100538

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169694_100538

Scaffold Ga0169694_100538

Overview

Basic Information
Taxon OID	3300029040 Open in IMG/M
Scaffold ID	Ga0169694_100538 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from infant at 12 months in Denmark - 39_12M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	37385
Total Scaffold Genes	38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (81.58%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location Name	Denmark
Coordinates	Lat. (^o)	55.678	Long. (^o)	12.531	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081453	Metagenome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169694_10053827	F081453	N/A	MSPFFLLAGDNIIEKHISANPVYVTNIKAPELAVKGAPGRKCIQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.