 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300029136 Open in IMG/M |
| Scaffold ID | Ga0168747_100227 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012245-136 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 107576 |
| Total Scaffold Genes | 94 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 87 (92.55%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041208 | Metagenome | 160 | N |
| F101193 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168747_10022724 | F101193 | GAGG | MARKCTEYHYFQHTYWDVMARYNWMRCPYCGKLCKPSRFKAATVLVPIEFVIFVVCIFFRNSMNDAIGWFAAWLLFVLLLFLPQYIYVRFFMPYETLSEDETRKFRDLQEH |
| Ga0168747_10022730 | F041208 | GGAGG | MRKILAMLLSVMLLLTAAVAETSAPYAPETVLPLVSNNRPYRDFARGAISSSEDAIEQAKAWLYLPLFVTNFSAKSEAVDWSAMRTEEGWYVTAYMRNTFVWLLMDEQGRVQAYDFDLLGNASLTYDGALPDNLDEAISSYIRRFADLNGFVEVADYAREEVTTFGDYAVAVTVQVTLDGTPYRFTMRLDMMAFTSVENANLHPTAAQTQRDILLLMRDNLAEKGVDIIQTFFAVQADDADGETKLTGIASFPADAASDAIREQYGELERYTLHYSGRASEAGIERVELSDWQETTATAQFPLALYALVDGKYLVPDGELAPGTAYLALDSMGLRGRNVIPLESITMLTRIRYARADGTFAESWVSSDMLTENDAAPAAPKREPIPTLESYQITLNGTAYTAFAINKVEKGYDTFADIAGTRMTVVDVLTNAAQGVIAEYGVDASDLLCRTVVEYGYRADKGCWQVDFTIPQRDMADDAYEVEVDDKDGKVTGMWGPQDGNG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |