NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120082_1025658

Scaffold Ga0120082_1025658


Overview

Basic Information
Taxon OID3300029200 Open in IMG/M
Scaffold IDGa0120082_1025658 Open in IMG/M
Source Dataset NameBiofilm microbial communities from University of Hong Kong - Biofilm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)628
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039700Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0120082_10256582F039700AGGAGMPLFEVAILEQPTKKEAEEGASEKLVFGPTAVVAPNQQSAAIAAVMDAKAPTNIDRNRMQVLVRPFA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.