NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0168685_102879

Scaffold Ga0168685_102879


Overview

Basic Information
Taxon OID3300029230 Open in IMG/M
Scaffold IDGa0168685_102879 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002668-39
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6549
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (61.11%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China

Source Dataset Sampling Location
Location NameChina: Beijing, Peking Union Medical College
CoordinatesLat. (o)39.911947Long. (o)116.4156125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078006Metagenome117N
F080673Metagenome115N

Sequences

Protein IDFamilyRBSSequence
Ga0168685_10287911F078006AGGAMLNQALAGRKEYHDRTCADMVRGRFPAPWHNLNVSSMEDNILKRAAAELKGAGCRVFAWQDDTYNRGWSKGDYTMLYYAFPDSPNIGYLSHGEYGMSVAYSRAYIPSCGSGSGCCVKEEATFDLETALDVLNGPLPRWCRSYGVYPKQYDNIDKWYNSDNHNKKLFKEI
Ga0168685_1028796F080673GGAMKLQDEALLYLRDNITREEAYYILTTENEMTEVLIAKKKDGGKRIKILDMEYTIERDDMLLLFDTDGIIDECLLTSSHIGINMYFRRQDIRDILSKKLEVMEYRYIKIQVDNIPVVEKRRVILDLTGHRVDRNDRDKIDFMFVYYMARLCV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.