NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169721_102474

Scaffold Ga0169721_102474


Overview

Basic Information
Taxon OID3300029236 Open in IMG/M
Scaffold IDGa0169721_102474 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from mother in Denmark - 507_M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12731
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (94.44%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location NameDenmark
CoordinatesLat. (o)55.678Long. (o)12.531Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056682Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0169721_10247414F056682N/AMKMQSRAGKVANQSIRQGKIYSASFGAFPSKNRSTFPIQKLGKNYKNQEVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.