Scaffold Ga0238435_120070

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0238435_120070

Scaffold Ga0238435_120070

Overview

Basic Information
Taxon OID	3300029349 Open in IMG/M
Scaffold ID	Ga0238435_120070 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	536
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Klamath Basin, Usa

Source Dataset Sampling Location
Location Name	USA: Iron Gate Dam, Klamath Basin, California
Coordinates	Lat. (^o)	41.93	Long. (^o)	-122.44	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000671	Metagenome / Metatranscriptome	945	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0238435_1200701	F000671	AGGAGG	MDKVLCYSCNKTKNKLSLKKSSLLPINLLMCESCTVSKFEPRWLIILAGRQQGSELVRDFVLKKKYIGVEITASELLI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.