Basic Information | |
---|---|
Taxon OID | 3300029358 Open in IMG/M |
Scaffold ID | Ga0243818_1010802 Open in IMG/M |
Source Dataset Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_12_stool_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2817 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Baltimore | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074964 | Metagenome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243818_10108023 | F074964 | N/A | MMTKKGVNKLQNAVIRENASNLAGAVKLYNTLFANGADLRAICKALEIPVEYAVKVSALAKDKKKLVTVCSLLLPKVGGTFVKFTLYSKIYKDSKVNKEKGIESKEVKNIAYGEEYKPFGFASPEPLEGKNSAKWLTRETDEYRATYVAVKITSYSIRMIAKCVSEYLAHESNQQ |
⦗Top⦘ |