Scaffold Ga0243998_1000332

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0243998_1000332

Scaffold Ga0243998_1000332

Overview

Basic Information
Taxon OID	3300029388 Open in IMG/M
Scaffold ID	Ga0243998_1000332 Open in IMG/M
Source Dataset Name	Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 096_4_29_stool_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute for Genome Sciences, University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	56018
Total Scaffold Genes	54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	48 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location Name	USA: Baltimore
Coordinates	Lat. (^o)	39.28846264	Long. (^o)	-76.62594594	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088914	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0243998_100033213	F088914	N/A	VGRILPVCSGFFVFWSRKEGANYQISVKSFSTLDSYDIIQLYIMTELTDGRVSDSLFSVPYTPKENIKNPGKFIVFSAWYAAKALEMDVK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.