NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0239577_1003392

Scaffold Ga0239577_1003392


Overview

Basic Information
Taxon OID3300029429 Open in IMG/M
Scaffold IDGa0239577_1003392 Open in IMG/M
Source Dataset NameOil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLawrence Berkeley National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3460
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location NameUSA: Gulf of Mexico
CoordinatesLat. (o)24.74Long. (o)-88.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101886Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0239577_10033922F101886N/AMLKKIAIIAFCLFNVALFIQIGIDVAAVTPEQAMLEGMTQRIYASISTLDYIMATLWGVILYTILTAKKEYFLRVSWLYLGFYLCDIHFSHYMSIEMNDPYFTPGALALVAVQIGFLFWAKIRINTANFALSN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.