Scaffold Ga0239577_1049495

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0239577_1049495

Scaffold Ga0239577_1049495

Overview

Basic Information
Taxon OID	3300029429 Open in IMG/M
Scaffold ID	Ga0239577_1049495 Open in IMG/M
Source Dataset Name	Oil enriched seawater microbial communities from Gulf of Mexico, USA - BD02T6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Lawrence Berkeley National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	636
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Oil Enriched Seawater → Oil Enriched Seawater Microbial Communities From Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location Name	USA: Gulf of Mexico
Coordinates	Lat. (^o)	24.74	Long. (^o)	-88.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101886	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0239577_10494951	F101886	AGGA	MLKKFAIIGFCLFNVVLFILIGIEVAAVTPERAMLEGVTQRIYASISTLDYIMAALWGAILYTILTAKTEHFLRASWLYLGFYLCDIHFSHYMSMEMNDPYFTPGALSLV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.