Scaffold Ga0167332_1025804

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167332_1025804

Scaffold Ga0167332_1025804

Overview

Basic Information
Taxon OID	3300029446 Open in IMG/M
Scaffold ID	Ga0167332_1025804 Open in IMG/M
Source Dataset Name	Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1487
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.355554	Long. (^o)	18.227079	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091585	Metagenome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0167332_10258042	F091585	GAG	MENYFNIVQNTVFTSFIGLFAPFLFPYFFKIVAKWSKRELTKQEKRILVGFVSFLVSLVIVAIGFDWQGEPTERVVAFITYIVLNFAALRGVVQSIYELVIKNIPSLDEELDRIEKGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.