NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183755_1001956

Scaffold Ga0183755_1001956


Overview

Basic Information
Taxon OID3300029448 Open in IMG/M
Scaffold IDGa0183755_1001956 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11195
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameMediterranean Sea: TARA_023
CoordinatesLat. (o)42.1735Long. (o)17.7252Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F002716Metagenome / Metatranscriptome535Y
F018357Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0183755_100195610F002716GAGGMSEYRLETEEDMSAYLDIEYGHGVSAVYTNSSGTAATINVILNNEYVEQEEGVGVEALKPIAYCRTVDVPSIAFGNTLNVSAIKDVDGNILKAAQNYTVVNIQSDRTGFSALMLEKI
Ga0183755_100195617F018357N/AMVQSDIDSDSGGSLTVLISPNLVASLANNEAVTVNKPSFTVYLENNEIMYSTDASGFYSISFDVREVIT
Ga0183755_10019569F001582AGAAGMPLESAADFNSYVDINTGHGVTATFFEVQNSLWDQRLGLIDTWYDIDSGNSTNINIIIDQEYFNIEGGTVPVAGYQPRAIVKSSDVPYISQQDRLVVNAITTNKGSVLKPETTFFVRTVEPDNTGLVSLVLEEQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.