Scaffold Ga0183755_1071833

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183755_1071833

Scaffold Ga0183755_1071833

Overview

Basic Information
Taxon OID	3300029448 Open in IMG/M
Scaffold ID	Ga0183755_1071833 Open in IMG/M
Source Dataset Name	Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	772
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Mediterranean Sea: TARA_023
Coordinates	Lat. (^o)	42.1735	Long. (^o)	17.7252	Alt. (m)		Depth (m)	55
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087764	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0183755_10718331	F087764	AGGA	MKRPTISEAKTFFYQNAPFVMDEYQDMKEDYGEFFAARYIIEILIDYRKNEKEASNG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.