Scaffold Ga0243128_1024438

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0243128_1024438

Scaffold Ga0243128_1024438

Overview

Basic Information
Taxon OID	3300029449 Open in IMG/M
Scaffold ID	Ga0243128_1024438 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Yellow Sea, Weihai, China - HGD.1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shandong University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2069
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China

Source Dataset Sampling Location
Location Name	China: Weihai
Coordinates	Lat. (^o)	37.31	Long. (^o)	122.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059891	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0243128_10244381	F059891	N/A	MDAAGFLKLKRGYWVIESALHHALDVTLREDHSRVRYPKAAFVLSLFRRIVVSFAQVWVAHCRKLNPKSRVTTRKFQQRFSRADGGPSRLHALMFAKSPVSWLSPA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.