Basic Information | |
---|---|
Taxon OID | 3300029511 Open in IMG/M |
Scaffold ID | Ga0244809_100004 Open in IMG/M |
Source Dataset Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005376-42 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 359436 |
Total Scaffold Genes | 355 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 315 (88.73%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067720 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0244809_100004167 | F067720 | GGAGG | MESTTYEHFVDTNKMYAAQEQFRDITKLVTKRHHFAVLGNMVRNAGQLPQPFWLGAARGGGSCSTARCAARA |
⦗Top⦘ |