Scaffold Ga0311280_100583

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0311280_100583

Scaffold Ga0311280_100583

Overview

Basic Information
Taxon OID	3300029569 Open in IMG/M
Scaffold ID	Ga0311280_100583 Open in IMG/M
Source Dataset Name	Moderately acidic thermal spring sediment microbial community from Yellowstone National Park, USA - MV2 Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7290
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (84.62%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Acidilobales → Acidilobaceae → Acidilobus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park, Wyoming
Coordinates	Lat. (^o)	44.61003889	Long. (^o)	-110.43943056	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051271	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311280_1005834	F051271	AGGAGG	VNCPKQKTLVMCSEGKEVELFDFVSQLILERIEDGTLRKADALRLLNRIERLYIKVHEFTTDEDNWLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.