NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311280_104596

Scaffold Ga0311280_104596


Overview

Basic Information
Taxon OID3300029569 Open in IMG/M
Scaffold IDGa0311280_104596 Open in IMG/M
Source Dataset NameModerately acidic thermal spring sediment microbial community from Yellowstone National Park, USA - MV2 Spring
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1162
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Acidilobales → Caldisphaeraceae → Caldisphaera → unclassified Caldisphaera → Caldisphaera sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park, Wyoming
CoordinatesLat. (o)44.61003889Long. (o)-110.43943056Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101504Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0311280_1045962F101504N/AATLTYLAYQHYLRRLDYQTNLEIKNFNASLIINLQPSVFDEIVGNTSFEANIMDKSYRYYNMRIPENKPFQHPKIKELQHIKDKFENMKVDIDKQKVEAMANNFMTFNSVVRRYKIVNNFVKLTAILNGHKTATSEDYNFVSKMLLNNIIESELLERKGFTSTFKFNVFLFNVMLMSKYYGNIFHYSKLKTYLNVSTKTIYNYAKANNVKIDNGYIIYDNERILKVLKHVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.