Scaffold Ga0311280_108105

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0311280_108105

Scaffold Ga0311280_108105

Overview

Basic Information
Taxon OID	3300029569 Open in IMG/M
Scaffold ID	Ga0311280_108105 Open in IMG/M
Source Dataset Name	Moderately acidic thermal spring sediment microbial community from Yellowstone National Park, USA - MV2 Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	789
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park, Wyoming
Coordinates	Lat. (^o)	44.61003889	Long. (^o)	-110.43943056	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102725	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311280_1081051	F102725	AGTAG	LVFXGGEKTKINVYQKLPEPEPNKEYTITKVEQGKGQYGEYIRLTLKDNEENEYSTALWIKDTVSAKSKAGAFAIVLGNDPTTWEGKRIKIISWTAKNREIQAVETSTTTKKGKXYKWKYKKKIMKKYIEYTEKE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.