NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0245205_1000171

Scaffold Ga0245205_1000171


Overview

Basic Information
Taxon OID3300029748 Open in IMG/M
Scaffold IDGa0245205_1000171 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37308R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)109664
Total Scaffold Genes101 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)87 (86.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Source Dataset Sampling Location
Location NameUnited Kingdom: London
CoordinatesLat. (o)51.5Long. (o)-0.12Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059982Metagenome133N

Sequences

Protein IDFamilyRBSSequence
Ga0245205_100017183F059982GGAGGMRRMTRLLCLMLLFSLITFSCPLAEETDAPTGTPAPTPMLTAVPESALAPFNVVLPEDAHVEMTEGRITLVRGDSRVVAMVISRVPDADPAAALPVLMQDFDPKTSETMDFDAQPGFCILGGVVNDAFGDGEDKITLMVLADSGELLILSGYNLARDHHALYLFLTELLENVSMDGAAVYVAEDAAATASPEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.