NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243738_1010512

Scaffold Ga0243738_1010512


Overview

Basic Information
Taxon OID3300029793 Open in IMG/M
Scaffold IDGa0243738_1010512 Open in IMG/M
Source Dataset NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 026_10_31_stool_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3510
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089591Metagenome109N
F089592Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0243738_10105122F089591AGGAGGMTIQEAYLRSLQKNEQNLANGGIKLDPGRFVLLFNEAQDRLVKYYLNRKDDETIRSIQNLLVYWMSLDNAGRMDDPESTSFNLPDDYLWFSNIKGVFSYKGCEATDFVMWEAKNENIHELLGDENNRPSYDYRETFYSIGNGKVVVYESGFRTEEVKMTYYRRPVRVDLSGYINAAGIQSTDIDPELPDYLVEEILDMVAKQFSLNENELNRYSMDKDNVASFK
Ga0243738_10105123F089592N/AMKEILKSRKVLAEVNGFNIMSDTLYEVVGKHDGSAPQAFQDANIAKAPFPENATHVCCPWDDFSKAYNTGFYPRSRCYNGLDKNEIDRLVKQRVDNIMKPFEEMSQMDLSQTNLEFWDDAKDKIFMGKVYNTANTVDLFYLYLAVFSGMLTPQEMDGDPVFMNSMFCFVEKDNMKDFVQQREINKMNISYKFISALKKGGDDRQAVIDLLLYIGIVTRPDFTEDEYYTGSXXXGSLSNWMNEKKTNVDYLLDIWDRSLEGDFKEVLEFYRIVNVLQRNGRINMTPSGLQYNGQIIGPDVRTSAEFLATKKDFINIKANVLDEYEEIISMSNIDDKSKTKKVKDIKKKDDVEEGDKVKEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.