Basic Information | |
---|---|
Taxon OID | 3300029797 Open in IMG/M |
Scaffold ID | Ga0243129_1058917 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shandong University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1298 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Weihai | |||||||
Coordinates | Lat. (o) | 37.31 | Long. (o) | 122.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072820 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243129_10589174 | F072820 | AGGAGG | MKPLHQITVDAVTIRGIIDYLEKSVEPVGLHEIAMTQHVSNATALRLCRILEKASIAEHPVVTRVVMGASQEVPQLAWQLTKPFFLGGCVYNAERLAGGMA |
⦗Top⦘ |