Scaffold Ga0239581_1001665

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0239581_1001665

Scaffold Ga0239581_1001665

Overview

Basic Information
Taxon OID	3300029798 Open in IMG/M
Scaffold ID	Ga0239581_1001665 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Uppsala University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12489
Total Scaffold Genes	30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	26 (86.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland

Source Dataset Sampling Location
Location Name	Finland: Alinen Mustajarvi in Hameenlinna
Coordinates	Lat. (^o)	61.208142	Long. (^o)	25.113609	Alt. (m)		Depth (m)	5.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057071	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0239581_100166522	F057071	GGA	VKIREHLKFHIFDAKQLTIAMTGAFSTWAATGFQHDMPHLGYILVGFITGGLVSHNSQADPNVSPESHIATPYAANIDDGGKTAPLPVDGYKGEGVDVKKVIKINSGLVK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.