Scaffold Ga0247275_1046211

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247275_1046211

Scaffold Ga0247275_1046211

Overview

Basic Information
Taxon OID	3300029817 Open in IMG/M
Scaffold ID	Ga0247275_1046211 Open in IMG/M
Source Dataset Name	Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1244
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa

Source Dataset Sampling Location
Location Name	USA: Minnesota, Marcell Experimental Forest
Coordinates	Lat. (^o)	47.5062	Long. (^o)	-93.45426667	Alt. (m)		Depth (m)	25 to 50
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065975	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247275_10462112	F065975	GGAGG	MRRAALILAILCTSAALAPAALAKDKDKGYQWKDAKVIDITSDRGGAVVVPVAALVGVPVTKTFYWIQTNDTIYVLGPVLTKSQLLNVTLHEPTKIAIDGSNAHILDDYGKDRKL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.