NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134854_1008972

Scaffold Ga0134854_1008972


Overview

Basic Information
Taxon OID3300029822 Open in IMG/M
Scaffold IDGa0134854_1008972 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4325
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Chengdu
CoordinatesLat. (o)30.65Long. (o)104.06Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029085Metagenome / Metatranscriptome189N
F047639Metagenome / Metatranscriptome149Y
F075995Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0134854_10089723F047639AGGAGMVMRFKKSNYIRVIKFNTDKSSNITYHKSKTYKPNFLINPNHIFFANGYRTIVISDKSAETINPLDFNSKFNPTDFETAIESKLIRDTFSTLKPKLIDTTTIMLLINLIFTFGVLYLLLKWQGMI
Ga0134854_10089724F029085GGAMENIKDDKLKIDELLEENISEQLENGSSDLVSLIAISELTNLNKLKVITRVKEEQVPVLTKLYMYAETFNIPFIKNMADNILQLQVSIRGLGRKELVNIVRESTPTEVKRGIFGTKDVFR
Ga0134854_10089725F075995N/AMSYRKLKKANVYISKNFKKVFYGMRTLYVKDLRNTRYSDFSGKVYVRYKNKYYQAHFDGRNTYNVRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.