NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134619_1000066

Scaffold Ga0134619_1000066


Overview

Basic Information
Taxon OID3300029826 Open in IMG/M
Scaffold IDGa0134619_1000066 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Jimmy Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - N0247
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBattelle Memorial Institute
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)48186
Total Scaffold Genes73 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)66 (90.41%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion

Source Dataset Sampling Location
Location NameUSA: Bay Jimmy
CoordinatesLat. (o)29.44Long. (o)-89.903Alt. (m)Depth (m).02 to .04
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039402Metagenome / Metatranscriptome164Y
F044014Metagenome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0134619_100006656F039402AGGAGMSLTDYSDLEGQIKDAPEPKTLPRGAEVKARIISVRDGVSDKNGAQWYSVVFDVPSDPMVIEFNDFFWDLADRDKLTEKEFQRSLRKFKLFAEAIGLDYSRPFSWADDLVGMECWVILGVKKSDEYGDQNTVSKYITGK
Ga0134619_100006669F044014GGAGGMSDEYKPRFIFEITEAQKERADRLLATYGLRKAVFSHILDDVLDILEEFGGASLGLLITGKCKPRDIIPTMKNASRGGELSNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.