Scaffold Ga0245329_102949

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0245329_102949

Scaffold Ga0245329_102949

Overview

Basic Information
Taxon OID	3300029885 Open in IMG/M
Scaffold ID	Ga0245329_102949 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35707
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8640
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Source Dataset Sampling Location
Location Name	United Kingdom: London
Coordinates	Lat. (^o)	51.5	Long. (^o)	-0.12	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075480	Metagenome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0245329_1029492	F075480	AGGAG	MNKTKQEKWQRAYGDTPDSFRQRVASALPKGEESRHVAFPRRAMVLAAALLLVLTTAYAAVVTHTELVWNAGHPIENEADDRLGLLTGKAGTSGDSLTIGGVTFTVQDGVYSLENGQLFASAVISADESVQLVAVEADMEHEVRLTTPVDAKLDPSGISWAEWAEQNGKTLVPIGMEAAPTLQFLKVNGQTTDTPLIGAFLTQNPDGTVSAGFQVDLTEADTSHLKSCEVQLECRVGAFGKDGKATQWQKEILTATITFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.