Scaffold Ga0246001_1036154

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0246001_1036154

Scaffold Ga0246001_1036154

Overview

Basic Information
Taxon OID	3300029889 Open in IMG/M
Scaffold ID	Ga0246001_1036154 Open in IMG/M
Source Dataset Name	Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1199
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat → Peat Microbial Communities From Marcell Experimental Forest Bog In Minnesota, Usa

Source Dataset Sampling Location
Location Name	USA: Minnesota
Coordinates	Lat. (^o)	47.506	Long. (^o)	-93.454	Alt. (m)		Depth (m)	.3 to .4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064319	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0246001_10361541	F064319	GGAGG	MRNAVVVLLVTLVAGIVQAQEVNIGPSQASIAGRMASKMKTSLEPLDVITTIHCEHSLMLCREEVAMLWVTDEGSFEVKHDSRIWEVQVWNTDTGSIQASRDGNTLQFSKEENLIVHHGHKDGIDTVHEFTIVTMDRWIAQK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.