NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247043_1016353

Scaffold Ga0247043_1016353


Overview

Basic Information
Taxon OID3300029895 Open in IMG/M
Scaffold IDGa0247043_1016353 Open in IMG/M
Source Dataset NameCryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDMAC, Technical University of Denmark
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2425
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location NameGreenland: Tasiilaq
CoordinatesLat. (o)65.38Long. (o)-38.53Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045483Metagenome152N

Sequences

Protein IDFamilyRBSSequence
Ga0247043_10163532F045483GAGMATMRRLFSALSVLGLSLLVLTGCVVPGGYDVNTLHVQPEAGLVYPGSTGVHTNDYNGSPGNYVSKGAVAATGKSGTTTHTQLEVLAYFSKTLAADGWKQTQEEVRAITPEGLPAHWIAWDKPKLHLSYLVEVWTVGEATKCYTQFGSNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.