Scaffold Ga0247043_1018446

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247043_1018446

Scaffold Ga0247043_1018446

Overview

Basic Information
Taxon OID	3300029895 Open in IMG/M
Scaffold ID	Ga0247043_1018446 Open in IMG/M
Source Dataset Name	Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DMAC, Technical University of Denmark
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2202
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location Name	Greenland: Tasiilaq
Coordinates	Lat. (^o)	65.38	Long. (^o)	-38.53	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045483	Metagenome	152	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0247043_10184461	F045483	GAG	MAKPRRLFSGLSVLGLSLFVLTGCAVPGGYDVNSLHLLPEAALVYPGSADVHTNDYGGSPGNYVSKGAVAVTGKSATTVHTQLEVLAYFSKTLAAGGWTQTGADDTATTPEGFRAKGISWVKNSLHLSYLVEVWTVGETTQYLTQLNANE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.