NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247048_1094614

Scaffold Ga0247048_1094614


Overview

Basic Information
Taxon OID3300029900 Open in IMG/M
Scaffold IDGa0247048_1094614 Open in IMG/M
Source Dataset NameCryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_U-A2b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDMAC, Technical University of Denmark
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)526
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location NameGreenland: Tasiilaq
CoordinatesLat. (o)65.41Long. (o)-38.51Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045483Metagenome152N

Sequences

Protein IDFamilyRBSSequence
Ga0247048_10946141F045483N/APMATMRRLFSALSVLGLSLLVLTGCVVPGGYDVNTLHVQPEAGLVYPGSTGVHTNDYNGSPGNYVSKGAVAATGKSGTTTHTQLEVLAYFSKTLAADGWKQTQEEVRAITPEGLPAHWIAWDKPKLHLSYLVEVWTVGEATKYYTQFGSNE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.