Basic Information | |
---|---|
Taxon OID | 3300029901 Open in IMG/M |
Scaffold ID | Ga0247051_1028652 Open in IMG/M |
Source Dataset Name | Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DMAC, Technical University of Denmark |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2112 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greenland: Kangerlussuaq | |||||||
Coordinates | Lat. (o) | 67.09 | Long. (o) | -50.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045483 | Metagenome | 152 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247051_10286521 | F045483 | N/A | CVVPGGYDVNSLHQLPESALVYPGSTGVDPYDYNGRPGNYIGKGAVAVTGKSATTIHTQLEVLAYFSQTLTADGWTKIGENDRGTTAEGIPSKDIAWVKNRLHLSYLVVVWTVGETTHYDTQLSANE |
⦗Top⦘ |