NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247271_100303

Scaffold Ga0247271_100303


Overview

Basic Information
Taxon OID3300029903 Open in IMG/M
Scaffold IDGa0247271_100303 Open in IMG/M
Source Dataset NameSoil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14059
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota, Marcell Experimental Forest
CoordinatesLat. (o)47.50505Long. (o)-93.48901667Alt. (m)Depth (m)0 to 10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010489Metagenome / Metatranscriptome303Y
F013472Metagenome / Metatranscriptome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0247271_10030312F010489GGALQKSASAVTILKIAITIEAECEDEISNAIFIVRGGSAQVIVQQFFAIGSMPSPTADMDLPKPTTQGNVLIAMPGPTSNGVKVLSVTDNAPAGSNTYKQVPGAASSCGKTQTLDIWYCENCNGGATELKFHLSGNARASINVFLELSEMPQSSILDGTGAHLDDGTRTSAGLEVGPTLKTTATDFVVARYNSTKPLPTGVVPESWTYKTTHVFKLNAPAGTYQPTLTGGGTAGTFCMSMAAFKTAPPAAPAP
Ga0247271_1003032F013472AGGAGMYARIVELLPKQDKKEEIVNIVRREILPLLKRQQGFLEFLPFVPETKTDNVIAVTLWAEKHEADRYHSEVYPKVEAILKPYLTAPPTFKRYTVETSFCQHFAEALWSEV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.