NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247271_100546

Scaffold Ga0247271_100546


Overview

Basic Information
Taxon OID3300029903 Open in IMG/M
Scaffold IDGa0247271_100546 Open in IMG/M
Source Dataset NameSoil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10434
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Marcell Experimental Forest, Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota, Marcell Experimental Forest
CoordinatesLat. (o)47.50505Long. (o)-93.48901667Alt. (m)Depth (m)0 to 10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030358Metagenome / Metatranscriptome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0247271_1005468F030358GGAGGMNGRNRAARAFVILGSLVLIASAALHCFAGYSKLASPALAASNLDSGLQAAFRVVFLALGWHWLVTAIVALLAGITETRLRKTLVLFCGLAVLLEAGVGASMMGFFVGNEMIGAAALLLVCGGLLFEKSGAQT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.