NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119944_1003335

Scaffold Ga0119944_1003335


Overview

Basic Information
Taxon OID3300029930 Open in IMG/M
Scaffold IDGa0119944_1003335 Open in IMG/M
Source Dataset NameAquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hong Kong
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2695
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment Plant In Pearl River Delta Area, China

Source Dataset Sampling Location
Location NameChina: Pearl River Delta area
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001515Metagenome / Metatranscriptome679Y
F005295Metagenome / Metatranscriptome405Y
F014728Metagenome / Metatranscriptome260Y

Sequences

Protein IDFamilyRBSSequence
Ga0119944_10033351F014728N/AMRWLREHEAVAERLTKAGAKDEGDLYVFLQGKTYIMELKNRKKLDLPAFWDEAQVEAKNYAKARGVAIPPAFVVVKRRNHGIEKSWVIQDLGQWMRERYE
Ga0119944_10033356F001515GGAMAKNSSFDLDFGYGRKGEQLVEELMTGGRTVEVKRDRKWWITNNIYIETECWYNKSQAWEPSGLSVTEAAYWAFVLEQSVFMVPTHILKKTVEQLGREISCEIPPNKSKGYLITVEDLLTGTRKWKNDKP
Ga0119944_10033357F005295GGAMNWDSIEEWDYIVVSVASEYYKKFPMCELEDIKQALYMWFAEHPNKLEHWKSLGEKDAKNLIYRSLRNQALDYCQKWKAKSIGYDVSDLYYYEPELVEVLLPTVLMGNFHIAPKLNLGKIGRPSAPAEGGNIQVMLLEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.