NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272449_1003972

Scaffold Ga0272449_1003972


Overview

Basic Information
Taxon OID3300029977 Open in IMG/M
Scaffold IDGa0272449_1003972 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12334
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (35.29%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5734Long. (o)-110.795Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009254Metagenome / Metatranscriptome320N
F013065Metagenome / Metatranscriptome274N
F044321Metagenome / Metatranscriptome154N
F096802Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0272449_100397211F013065N/AMARRIARDATIAIQFGGVDDGSAITWGAATQIEGKCSEISIDYRSQSVNLAGLSDAYARMRSAGAAEYTIRIRAFIPTDSYDFYVSGNPPLHQRARVRIKPRSTLQTDAEYTGVINKWSWSAQAGQEQVEEIEIVGPLDV
Ga0272449_100397212F009254N/AMRLRELEAYLRNFLARVVGVPIVSAPTALPVGSAVAGVLSLQSREAGKAVGGMRAVYQLELLASDAIPDAERRRLYETLASQIIRTELAAERDWLPMLDYQVFLEELSVERLRVRLEVEWDADR
Ga0272449_10039722F044321N/AMPAAEHECIWDLWYALLPRGAWELLERLGESERAALEEWLSSVRDPTRAPPPEPVRAALEKLQQWLDEDVS
Ga0272449_10039729F096802GGCGGMTLCVRYLHRHPLELSHLPATAIADLLALGTVEAELLADAEPL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.