NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0299907_11165535

Scaffold Ga0299907_11165535


Overview

Basic Information
Taxon OID3300030006 Open in IMG/M
Scaffold IDGa0299907_11165535 Open in IMG/M
Source Dataset NameSoil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)555
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)42.9888Long. (o)-108.3994Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024053Metagenome / Metatranscriptome207Y

Sequences

Protein IDFamilyRBSSequence
Ga0299907_111655351F024053N/ALPALLPERGNDRVRGRRYGRRMAKSAAAGVDVAVVEEHLARYAVSCPLCKAVDRLGVGQHPCELSSPGNGKDSIPVIVVMCTRCGYLMPLAADRVSPGEEKAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.